PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco020033.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family NAC
Protein Properties Length: 327aa    MW: 36737.6 Da    PI: 8.1081
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco020033.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.68.1e-5651301128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+++yL++kv++  + + ++i++vd++k+ePwdLp k++ +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+++  g 
  Aco020033.1   5 LPPGFRFHPTDEELITYYLTRKVTEFGFVA-RAIADVDLNKCEPWDLPGKASMGEKEWYFFSMRDRKYPTGLRTNRATDAGYWKTTGKDKEIFH-CGV 100
                  79*************************999.89***************988999****************************************.9** PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  lvg+kktLvfykgrapkgekt+Wvmheyrl
  Aco020033.1 101 LVGMKKTLVFYKGRAPKGEKTNWVMHEYRL 130
                  ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-653151IPR003441NAC domain
PROSITE profilePS5100560.2335151IPR003441NAC domain
PfamPF023653.1E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MEENLPPGFR FHPTDEELIT YYLTRKVTEF GFVARAIADV DLNKCEPWDL PGKASMGEKE  60
WYFFSMRDRK YPTGLRTNRA TDAGYWKTTG KDKEIFHCGV LVGMKKTLVF YKGRAPKGEK  120
TNWVMHEYRL QSKFPFRTTK EEWVVCRVFK KSSILKKPQA GSPPLPSLLE SPCNTNSLSE  180
LGEIDVSVLN NLMNASSSTS DIQANENISN KVDMSTYMHW VLAREAAASQ NTLPWPPNLL  240
GSVLASNPGI LKALPLINCY NQPREGTNLA NLSSFVAHGD GIFANESKLS FNGSSSKGAE  300
CAQQQQQQQQ QQQQEAFDQE AIWRGY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-58415716171NO APICAL MERISTEM PROTEIN
1ut4_B4e-58415716171NO APICAL MERISTEM PROTEIN
1ut7_A4e-58415716171NO APICAL MERISTEM PROTEIN
1ut7_B4e-58415716171NO APICAL MERISTEM PROTEIN
3swm_A4e-58415719174NAC domain-containing protein 19
3swm_B4e-58415719174NAC domain-containing protein 19
3swm_C4e-58415719174NAC domain-containing protein 19
3swm_D4e-58415719174NAC domain-containing protein 19
3swp_A4e-58415719174NAC domain-containing protein 19
3swp_B4e-58415719174NAC domain-containing protein 19
3swp_C4e-58415719174NAC domain-containing protein 19
3swp_D4e-58415719174NAC domain-containing protein 19
4dul_A4e-58415716171NAC domain-containing protein 19
4dul_B4e-58415716171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010926039.11e-165PREDICTED: NAC domain-containing protein 100-like
TrEMBLM0RJR51e-131M0RJR5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P19900_0011e-131(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-105NAC domain containing protein 58